PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C02391.1.p
Common NameEUGRSUZ_C02391, LOC104439659
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 368aa    MW: 41106.8 Da    PI: 6.1682
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C02391.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.9e-151462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W++eEd +l+d++++ G+g +W + ++++g++R++k+c++rw++yl
  Eucgr.C02391.1.p 14 RGPWSAEEDAKLKDYIEKDGTGgNWIALPQKIGLNRCGKSCRLRWLNYL 62
                      89*********************************************97 PP

2Myb_DNA-binding37.74.6e-1269111246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +++eEd l+  +    G++ W+ Ia+ ++ gRt++++k++w++
  Eucgr.C02391.1.p  69 GGFSEEEDNLICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                       569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.871962IPR017930Myb domain
SuperFamilySSF466892.3E-2611109IPR009057Homeodomain-like
SMARTSM007171.2E-101364IPR001005SANT/Myb domain
PfamPF002495.5E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-231569IPR009057Homeodomain-like
CDDcd001672.85E-81662No hitNo description
PROSITE profilePS5129421.29263117IPR017930Myb domain
SMARTSM007177.1E-1167115IPR001005SANT/Myb domain
PfamPF002497.9E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2270117IPR009057Homeodomain-like
CDDcd001672.32E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSAE EDAKLKDYIE KDGTGGNWIA LPQKIGLNRC GKSCRLRWLN  60
YLRPNIRHGG FSEEEDNLIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLGR  120
RRESLLNRSS SMKDAHSSKD ATSSQALSNS ALERLQLHMQ LQNLQSPFSF YNNPALWPKV  180
PPLLHEKMTQ SLQILNESPY QLMQPTLSSS SSPKNDQKAE THESSPAASH SAPSDFANLS  240
FNDADFSELV NSMTNCVSSS DRYVSLPDIG VNSIDQPNRT QFLPDPIIHT ELDNSLNCNK  300
SDGSMSQQNQ VDEFCFKDMN STSRDPLQAL WCDNEYSGQS ASSYCWDSTS ALLCEGISQD  360
YGFGYNM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-24141177108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C02391.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010050986.10.0PREDICTED: transcription factor RAX3-like
SwissprotQ9FKL21e-105MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A059CRN10.0A0A059CRN1_EUCGR; Uncharacterized protein
STRINGPOPTR_0006s18620.11e-126(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78982639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-94myb domain protein 36